Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial

Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial

SKU:P24394

Regular price $1,179.80 CAD
Regular price Sale price $1,179.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Immunology

Uniprot ID: P24394

Gene Names: IL4R

Alternative Name(s): IL-4 receptor subunit alpha;IL-4R subunit alpha;IL-4R-alpha;IL-4RA;CD antigen CD124;Soluble IL-4 receptor subunit alpha;Soluble IL-4R-alpha;sIL4Ralpha/prot;IL-4-binding protein;IL4-BP

Abbreviation: Recombinant Human IL4R protein, partial

Organism: Homo sapiens (Human)

Source: Yeast

Expression Region: 26-232aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

MW: 25.2 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2. ; Soluble IL4R (sIL4R) inhibits IL4-mediated cell proliferation and IL5 up-regulation by T-cells.

Reference:

Function:

View full details