Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Interleukin-3 receptor subunit alpha(IL3RA)

Recombinant Human Interleukin-3 receptor subunit alpha(IL3RA)

SKU:CSB-CF011658HU

Regular price $2,401.00 CAD
Regular price Sale price $2,401.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P26951

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT

Protein Names:Recommended name: Interleukin-3 receptor subunit alpha Short name= IL-3 receptor subunit alpha Short name= IL-3R subunit alpha Short name= IL-3R-alpha Short name= IL-3RA Alternative name(s): CD_antigen= CD123

Gene Names:Name:IL3RA Synonyms:IL3R

Expression Region:19-378

Sequence Info:full length protein

View full details