Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Interferon alpha-inducible protein 27-like protein 2(IFI27L2)

Recombinant Human Interferon alpha-inducible protein 27-like protein 2(IFI27L2)

SKU:CSB-CF884454HU-GB

Regular price $2,025.80 CAD
Regular price Sale price $2,025.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9H2X8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AMGFTGAGIAASSIAAKMMSAAAIANGGGVSAGSLVATLQSVGAAGLSTSSNILLASVGS VLGACLGNSPSSSLPAEPEAKEDEARENVPQGEPPKPPLKSEKHEE

Protein Names:Recommended name: Interferon alpha-inducible protein 27-like protein 2 Alternative name(s): Interferon-stimulated gene 12b protein Short name= ISG12(b) Protein TLH29 pIFI27-like protein

Gene Names:Name:IFI27L2 Synonyms:FAM14A, TLH29

Expression Region:25-130

Sequence Info:full length protein

View full details