Gene Bio Systems
Recombinant Human Interferon alpha-inducible protein 27-like protein 1(IFI27L1)
Recombinant Human Interferon alpha-inducible protein 27-like protein 1(IFI27L1)
SKU:CSB-CF836188HU-GB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q96BM0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGG GVAAGSLVAILQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS
Protein Names:Recommended name: Interferon alpha-inducible protein 27-like protein 1 Alternative name(s): Interferon-stimulated gene 12c protein Short name= ISG12(c)
Gene Names:Name:IFI27L1 Synonyms:FAM14B
Expression Region:1-104
Sequence Info:full length protein
