Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5(ITIH5),Partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5(ITIH5),Partial

CSB-EP768213HU
Regular price
$886.25 CAD
Sale price
$886.25 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Cancer

Target / Protein: ITIH5

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q86UX2

AA Sequence: VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 35-161aa

Protein length: Partial

MW: 30.6 kDa

Alternative Name(s):

Relevance: May act as a tumor suppressor.

Reference: ITIH5, a novel member of the inter-alpha-trypsin inhibitor heavy chain family is downregulated in breast cancer.Himmelfarb M., Klopocki E., Grube S., Staub E., Klaman I., Hinzmann B., Kristiansen G., Rosenthal A., Duerst M., Dahl E.Cancer Lett. 204:69-77(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share