
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: Q9GZP8
Gene Names: IMUP
Organism: Homo sapiens (Human)
AA Sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM
Expression Region: 1-85aa
Sequence Info: Full Length of Isoform 2
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 35.5 kDa
Alternative Name(s): Hepatocyte growth factor activator inhibitor type 2-related small protein ;H2RSP ;HAI-2-related small protein
Relevance:
Reference: Identification of cDNAs encoding two novel nuclear proteins, IMUP-1 and IMUP-2, upregulated in SV40-immortalized human fibroblasts.Kim J.K., Ryll R., Ishizuka Y., Kato S.Gene 257:327-334(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.