Gene Bio Systems
Recombinant Human ICOS ligand(ICOSLG)
Recombinant Human ICOS ligand(ICOSLG)
SKU:CSB-CF010958HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O75144
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Protein Names:Recommended name: ICOS ligand Alternative name(s): B7 homolog 2 Short name= B7-H2 B7-like protein Gl50 B7-related protein 1 Short name= B7RP-1 CD_antigen= CD275
Gene Names:Name:ICOSLG Synonyms:B7H2, B7RP1, ICOSL, KIAA0653
Expression Region:19-302
Sequence Info:full length protein
