Gene Bio Systems
Recombinant Human HLA class II histocompatibility antigen gamma chain(CD74)
Recombinant Human HLA class II histocompatibility antigen gamma chain(CD74)
SKU:CSB-CF004956HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P04233
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Protein Names:Recommended name: HLA class II histocompatibility antigen gamma chain Alternative name(s): HLA-DR antigens-associated invariant chain Ia antigen-associated invariant chain Short name= Ii p33 CD_antigen= CD74
Gene Names:Name:CD74 Synonyms:DHLAG
Expression Region:1-296
Sequence Info:full length protein
