Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human HLA class II histocompatibility antigen, DRB1-14 beta chain(HLA-DRB1)

Recombinant Human HLA class II histocompatibility antigen, DRB1-14 beta chain(HLA-DRB1)

SKU:CSB-CF872375HU

Regular price $1,981.25 CAD
Regular price Sale price $1,981.25 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9GIY3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GDTRPRFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPAAEH WNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHYNLLVCSVS GFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSV TSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS

Protein Names:Recommended name: HLA class II histocompatibility antigen, DRB1-14 beta chain Alternative name(s): MHC class II antigen DRB1*14 Short name= DR-14 Short name= DR14

Gene Names:Name:HLA-DRB1

Expression Region:30-266

Sequence Info:full length protein

View full details