Recombinant Human HLA class I histocompatibility antigen, alpha chain E(HLA-E) ,partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human HLA class I histocompatibility antigen, alpha chain E(HLA-E) ,partial

CSB-EP320269HU
Regular price
$709.00 CAD
Sale price
$709.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Immunology

Target / Protein: HLA-E

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P13747

AA Sequence: GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 22-305aa

Protein length: Extracellular Domain

MW: 48.7 kDa

Alternative Name(s): MHC class I antigen E

Relevance: Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.

Reference: Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share