Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human HLA-C protein(HLA-C),partial

Recombinant Human HLA-C protein(HLA-C),partial

SKU:CSB-RP150994h

Regular price $886.25 CAD
Regular price Sale price $886.25 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Immunology

Uniprot ID: O78179

Gene Names: HLA-C

Organism: Homo sapiens (Human)

AA Sequence: CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI

Expression Region: 25-308aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 36.7 kDa

Alternative Name(s):

Relevance: Involved in the presentation of foreign antigens to the immune syst.SAAS annotation

Reference: "HLA-C(*)03 is a risk factor for cardiomyopathy in Chagas disease."Layrisse Z., Fernandez M.T., Montagnani S., Matos M., Balbas O., Herrera F., Colorado I.A., Catalioti F., Acquatella H.Hum. Immunol. 61:925-929(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details