Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Histo-blood group ABO system transferase(ABO)

Recombinant Human Histo-blood group ABO system transferase(ABO)

SKU:CSB-CF001110HU

Regular price $2,392.60 CAD
Regular price Sale price $2,392.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P16442

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP

Protein Names:Recommended name: Histo-blood group ABO system transferase Alternative name(s): Fucosylglycoprotein 3-alpha-galactosyltransferase Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase EC= 2.4.1.40 Glycoprotein-fucosylgalactoside alpha-galactosyltransferase EC= 2.4.1.37 Histo-blood group A transferase Short name= A transferase Histo-blood group B transferase Short name= B transferase NAGAT Cleaved into the following chain: 1. Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase soluble form

Gene Names:Name:ABO

Expression Region:1-354

Sequence Info:full length protein

View full details