Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human HERV-K_16p3.3 provirus ancestral Env polyprotein

Recombinant Human HERV-K_16p3.3 provirus ancestral Env polyprotein

SKU:CSB-CF882131HU

Regular price $2,154.60 CAD
Regular price Sale price $2,154.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9NX77

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:FIFTLIAVLAGLLAVTATAATAGVAIRSSVQTAHYVEACQKNSSRLWNSQAQIDQKLANQ INDLRQSVTWLGDRVMNLQHRMQLQCDWNTSDYCITPYAYNQDQHSWENVSRHLKAWDDN LTLDISQLKEQIFEASQAHLSTVPGSHIFEGITKQLPDFNPFKWLKPVRGSLLLLALLIL VCLCCLLLVCRCL

Protein Names:Recommended name: HERV-K_16p3.3 provirus ancestral Env polyprotein Alternative name(s): Envelope polyprotein Cleaved into the following 2 chains: 1. Surface protein Short name= 2. SU 3. Transmembrane protein Short name= 4. TM

Gene Names:

Expression Region:290-482

Sequence Info:full length protein

View full details