Gene Bio Systems
Recombinant Human HERV-K_16p3.3 provirus ancestral Env polyprotein
Recombinant Human HERV-K_16p3.3 provirus ancestral Env polyprotein
SKU:CSB-CF882131HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q9NX77
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:FIFTLIAVLAGLLAVTATAATAGVAIRSSVQTAHYVEACQKNSSRLWNSQAQIDQKLANQ INDLRQSVTWLGDRVMNLQHRMQLQCDWNTSDYCITPYAYNQDQHSWENVSRHLKAWDDN LTLDISQLKEQIFEASQAHLSTVPGSHIFEGITKQLPDFNPFKWLKPVRGSLLLLALLIL VCLCCLLLVCRCL
Protein Names:Recommended name: HERV-K_16p3.3 provirus ancestral Env polyprotein Alternative name(s): Envelope polyprotein Cleaved into the following 2 chains: 1. Surface protein Short name= 2. SU 3. Transmembrane protein Short name= 4. TM
Gene Names:
Expression Region:290-482
Sequence Info:full length protein
