GeneBio Systems
Recombinant Human herpesvirus 6B G-protein coupled receptor (U12), partial
Recombinant Human herpesvirus 6B G-protein coupled receptor (U12), partial
SKU:Q9QJ51
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q9QJ51
Gene Names: U12
Alternative Name(s):
Abbreviation: Recombinant Human herpesvirus 6B G-protein coupled receptor protein, partial
Organism: Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Source: E.coli
Expression Region: 1-39aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-KSI-tagged
Target Protein Sequence: MDTVIELSKLLHDEEFKDNASCTSTPTLKTARIIESAVT
MW: 19.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference: "A strongly immunoreactive virion protein of human herpesvirus 6 variant B strain Z29: identification and characterization of the gene and mapping of a variant-specific monoclonal antibody reactive epitope." Pellett P.E., Sanchez-Martinez D., Dominguez G., Black J.B., Anton E., Greenamoyer C., Dambaugh T.R. Virology 195: 521-531(1993)
Function:
