Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human herpesvirus 6A DNA polymerase processivity factor(U27)

Recombinant Human herpesvirus 6A DNA polymerase processivity factor(U27)

SKU:CSB-YP346759HJZ

Regular price $1,287.40 CAD
Regular price Sale price $1,287.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P52439

Gene Names: U27

Organism: Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

AA Sequence: MCWSFHLFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHRETREPPTLAFHMKSWKTINKSLKAFAKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAHIIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMRFNLSAKNLQQALSMCAVIKTSCSLRTVAAKDCKLILTSKSTLLTVEAFLTQEQLKEESRFERMGKQDDGKGDRSHKNDDGSALASKQEMQYKITNYMVPAKNGTAGSSLFNEKEDSESDDSMHFDYSSNPNPKRQRCVV

Expression Region: 1-393aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 46.8 kDa

Alternative Name(s): Phosphoprotein P41 ;PP41;Polymerase accessory protein ;PAP

Relevance: Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization.

Reference: Identification, characterization, and sequence analysis of a cDNA encoding a phosphoprotein of human herpesvirus 6.Chang C.K., Balachandran N.J. Virol. 65:2884-2894(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details