Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
Uniprot NO.:Q86539
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:EPPNAAGARGVIGDAQCRGDSAGVVSVPGVLVPFYLGMTSMGVCMIAHVYQICQRALAAG SA
Protein Names:Recommended name: Glycoprotein N Short name= gN Alternative name(s): Protein UL49.5 Protein UL49A
Gene Names:
Expression Region:26-87
Sequence Info:full length protein