Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human herpesvirus 1 Envelope protein UL45 (UL45)

Recombinant Human herpesvirus 1 Envelope protein UL45 (UL45)

SKU:CSB-CF338978HSP

Regular price $2,123.80 CAD
Regular price Sale price $2,123.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)

Uniprot NO.:P28987

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPLRASEHAYRPLGPGTPPMRARLPAAAWVGVGTIIGGVVIIAALVLVPSRASWALSPCD SGWHEFNLGCISWDPTPMEHEQAVGGCSAPATLIPRAAAKQLAAVARVQSARSSGYWWVS GDGIRARLRLVDGVGGIDQFCEEPALRICYYPRSPGGFVQFVTSTRNALGLP

Protein Names:Recommended name: Envelope protein UL45 Alternative name(s): 18 kDa protein

Gene Names:ORF Names:UL45

Expression Region:1-172

Sequence Info:full length protein

View full details