Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P06484
Gene Names: gG US4
Organism: Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)
AA Sequence: VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALD
Expression Region: 25-189aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 33.4 kDa
Alternative Name(s): gG-1
Relevance: Chokine-binding protein that inhibits neutrophils' chotaxis.
Reference: Herpes simplex virus type 1 bacterial artificial chromosome.Cunningham C., Davison A.J. Comprehensive characterization of Extracellular domain herpes simplex virus type 1 virions.Loret S., Guay G., Lippe R.J. Virol. 82:8605-8618(2008)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.