Recombinant Human Guanylate cyclase activator 2B(GUCA2B)

Recombinant Human Guanylate cyclase activator 2B(GUCA2B)

CSB-YP613693HU
Regular price
$791.85 CAD
Sale price
$791.85 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Signal Transduction

Uniprot ID: Q16661

Gene Names: GUCA2B

Organism: Homo sapiens (Human)

AA Sequence: VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL

Expression Region: 27-112aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 11.5 kDa

Alternative Name(s): Guanylate cyclase C-activating peptide II ;GCAP-IIUroguanylin ;UGN

Relevance: Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.

Reference: Cloning and characterization of a cDNA encoding a precursor for human uroguanylin.Miyazato M., Nakazato M., Yamaguchi H., Date Y., Kojima M., Kangawa K., Matsuo H., Matsukura S.Biochem. Biophys. Res. Commun. 219:644-648(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share