Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P09341
Gene Names: CXCL1
Organism: Homo sapiens (Human)
AA Sequence: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Expression Region: 35-107aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 11.9 kDa
Alternative Name(s): C-X-C motif chemokine 1;GRO-alpha(1-73)Melanoma growth stimulatory activity ;MGSANeutrophil-activating protein 3 ;NAP-3
Relevance: Has chotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chotactic activity.
Reference: Constitutive overexpression of a growth-regulated gene in transformed Chinese hamster and human cells.Anisowicz A., Bardwell L., Sager R.Proc. Natl. Acad. Sci. U.S.A. 84:7188-7192(1987)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.