Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cardiovascular
Uniprot ID: Q99988
Gene Names: GDF15
Organism: Homo sapiens (Human)
AA Sequence: RNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Expression Region: 198-308aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 16.2 kDa
Alternative Name(s): Macrophage inhibitory cytokine 1 ;MIC-1NSAID-activated gene 1 protein ;NAG-1NSAID-regulated gene 1 protein ;NRG-1;Placental TGF-betaPlacental bone morphogenetic protein;Prostate differentiation factor
Relevance:
Reference: PLAB, a novel placental bone morphogenetic protein.Hromas R., Hufford M., Sutton J., Xu D., Li Y., Lu L.Biochim. Biophys. Acta 1354:40-44(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.