Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Growth arrest and DNA damage-inducible protein GADD45 gamma(GADD45G)

Recombinant Human Growth arrest and DNA damage-inducible protein GADD45 gamma(GADD45G)

SKU:CSB-EP009164HU

Regular price $992.60 CAD
Regular price Sale price $992.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: O95257

Gene Names: GADD45G

Organism: Homo sapiens (Human)

AA Sequence: MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

Expression Region: 1-159aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 33.1 kDa

Alternative Name(s): Cytokine-responsive protein CR6DNA damage-inducible transcript 2 protein ;DDIT-2

Relevance: Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.

Reference: A family of stress-inducible GADD45-like proteins mediate activation of the stress-responsive MTK1/MEKK4 MAPKKK.Takekawa M., Saito H.Cell 95:521-530(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details