Gene Bio Systems
Recombinant Human Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1(GPIHBP1)
Recombinant Human Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1(GPIHBP1)
SKU:CSB-CF811603HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q8IV16
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLT QNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPP WQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP
Protein Names:Recommended name: Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 Short name= GPI-HBP1 Short name= GPI-anchored HDL-binding protein 1 Alternative name(s): High density lipoprotein-binding protein 1
Gene Names:Name:GPIHBP1 Synonyms:HBP1
Expression Region:21-184
Sequence Info:full length protein
