>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug
Updated Date: Stock Protein updated on 20171018
Research areas: Tags & Cell Markers
Target / Protein: PAEP
Biologically active: Not Tested
Expression system: Mammalian cell
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P09466
AA Sequence: MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 19-180aa
Protein length: Full Length of Mature Protein
MW: 23,9
Alternative Name(s): Placental protein 14 Short name:PP14
Relevance: This protein is, quantitatively, the main protein synthe>Several Other Sizes Are Also Available. Please Inquire. Default Sized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy.
Reference: "Multiple forms of mRNA encoding human pregnancy-associated endometrial alpha 2-globulin, a beta-lactoglobulin homologue."Garde J., Bell S.C., Eperon I.C.Proc. Natl. Acad. Sci. U.S.A. 88:2456-2460(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.