Gene Bio Systems
Recombinant Human Gilles de la Tourette syndrome chromosomal region candidate gene 1 protein(GTSCR1)
Recombinant Human Gilles de la Tourette syndrome chromosomal region candidate gene 1 protein(GTSCR1)
SKU:CSB-CF773031HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q86UQ5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQSDIYHPGHSFPSWVLCKVTYTILATASQVGSFARKTHQNGDLQIRGGRGRRESTEIFQ VASVTEGEESPPAICMEVFLFLWFIAPIYACVCRIFKIQVRNTVKNSSTASLAPSISTSE ERQIRIERHHYHLYGQ
Protein Names:Recommended name: Gilles de la Tourette syndrome chromosomal region candidate gene 1 protein
Gene Names:Name:GTSCR1
Expression Region:1-136
Sequence Info:full length protein
