GeneBio Systems
Recombinant Human Gamma-glutamyl hydrolase (GGH), partial
Recombinant Human Gamma-glutamyl hydrolase (GGH), partial
SKU:Q92820
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Metabolism
Uniprot ID: Q92820
Gene Names: GGH
Alternative Name(s): (Conjugase)(GH)(Gamma-Glu-X carboxypeptidase)
Abbreviation: Recombinant Human GGH protein, partial
Organism: Homo sapiens (Human)
Source: E.coli
Expression Region: 219-293aa
Protein Length: Partial
Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Target Protein Sequence: TNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHAPNAVKTAFYLAEFFVNEARKNNHHFKSESEEE
MW: 43.9 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Hydrolyzes the polyglutamate sidechains of pteroylpolyglutamates. Progressively removes gamma-glutamyl residues from pteroylpoly-gamma-glutamate to yield pteroyl-alpha-glutamate (folic acid) and free glutamate. May play an important role in the bioavailability of dietary pteroylpolyglutamates and in the metabolism of pteroylpolyglutamates and antifolates.
Reference: "Molecular modeling and site-directed mutagenesis define the catalytic motif in human gamma -glutamyl hydrolase." Chave K.J., Auger I.E., Galivan J., Ryan T.J. J. Biol. Chem. 275: 40365-40370(2000)
Function:
