Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Gamma-crystallin B(CRYGB)

Recombinant Human Gamma-crystallin B(CRYGB)

SKU:CSB-EP006018HU

Regular price $1,191.96 CAD
Regular price Sale price $1,191.96 CAD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Neuroscience

Uniprot ID:P07316

Gene Names:CRYGB

Organism:Homo sapiens (Human)

AA Sequence:MGKITFYEDRAFQGRSYECTTDCPNLQPYFSRCNSIRVESGCWMIYERPNYQGHQYFLRRGEYPDYQQWMGLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCISVQDRFHLTEIHSLNVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLY

Expression Region:1-175aa

Sequence Info:Full Length

Source:E.coli

Tag Info:N-terminal 6xHis-tagged

MW:24.9 kDa

Alternative Name(s):Gamma-B-crystallin (Gamma-crystallin 1-2) (CRYG2)

Relevance:Crystallins are the dominant structural components of the vertebrate eye lens.

Reference:"Two human gamma-crystallin genes are linked and riddled with Alu-repeats." den Dunnen J.T., Moormann R.J.M., Cremers F.P.M., Schoenmakers J.G.G. Gene 38:197-204(1985)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Crystallins are the dominant structural components of the vertebrate eye lens.

Involvement in disease:Cataract 39, multiple types (CTRCT39)

Subcellular Location:

Protein Families:Beta/gamma-crystallin family

Tissue Specificity:

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:2409

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=248102

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:1419

STRING Database Link:https://string-db.org/network/9606.ENSP00000260988

OMIM Database Link:https://www.omim.org/entry/123670123670123670

Lead Time Guidance:13-23 business days

View full details