Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Neuroscience
Uniprot ID: Q9H0R8
Gene Names: GABARAPL1
Organism: Homo sapiens (Human)
AA Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG
Expression Region: 1-117aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 40.9 kDa
Alternative Name(s): Early estrogen-regulated protein GABA(A) receptor-associated protein-like 1 Glandular epithelial cell protein 1
Relevance: Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
Reference: "A novel early estrogen-regulated gene gec1 encodes a protein related to GABARAP." Vernier-Magnin S., Muller S., Sallot M., Radom J., Musard J.-F., Adami P., Dulieu P., Remy-Martin J.-P., Jouvenot M., Fraichard A. Biochem. Biophys. Res. Commun. 284:118-125(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.