Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P21462
Gene Names: FPR1
Organism: Homo sapiens (Human)
AA Sequence: QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
Expression Region: 306-350aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
MW: 34.9 kDa
Alternative Name(s): N-formyl peptide receptor Short name: FPR N-formylpeptide chemoattractant receptor
Relevance: High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system
Reference: "Synthesis and use of a novel N-formyl peptide derivative to isolate a human N-formyl peptide receptor cDNA." Boulay F., Tardif M., Brouchon L., Vignais P. Biochem. Biophys. Res. Commun. 168:1103-1109(1990)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.