Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Neuroscience
Uniprot ID: P48664
Gene Names: SLC1A6
Organism: Homo sapiens (Human)
AA Sequence: MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL
Expression Region: 149-271aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 40.4 kDa
Alternative Name(s): Sodium-dependent glutamate/aspartate transporter Solute carrier family 1 member 6
Relevance: Transports L-glutamate and also L- and D-aspartate. Seems to act as a symport by cotransporting sodium.
Reference: "An excitatory amino-acid transporter with properties of a ligand-gated chloride channel."Fairman W.A., Vandenberg R.J., Arriza J.L., Kavanaugh M.P., Amara S.G.Nature 375:599-603(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.