Recombinant Human Excitatory amino acid transporter 4(SLC1A6),partial

SKU: CSB-EP021437HU

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: P48664

Gene Names: SLC1A6

Organism: Homo sapiens (Human)

AA Sequence: MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL

Expression Region: 149-271aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 40.4 kDa

Alternative Name(s): Sodium-dependent glutamate/aspartate transporter Solute carrier family 1 member 6

Relevance: Transports L-glutamate and also L- and D-aspartate. Seems to act as a symport by cotransporting sodium.

Reference: "An excitatory amino-acid transporter with properties of a ligand-gated chloride channel."Fairman W.A., Vandenberg R.J., Arriza J.L., Kavanaugh M.P., Amara S.G.Nature 375:599-603(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.