Gene Bio Systems
Recombinant Human ER lumen protein retaining receptor 1(KDELR1)
Recombinant Human ER lumen protein retaining receptor 1(KDELR1)
SKU:CSB-CF012129HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P24390
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNLFRFLGDLSHLLAIILLLLKIWKSRSCAGISGKSQVLFAVVFTARYLDLFTNYISLYN TCMKVVYIACSFTTVWLIYSKFKATYDGNHDTFRVEFLVVPTAILAFLVNHDFTPLEILW TFSIYLESVAILPQLFMVSKTGEAETITSHYLFALGVYRTLYLFNWIWRYHFEGFFDLIA IVAGLVQTVLYCDFFYLYITKVLKGKKLSLPA
Protein Names:Recommended name: ER lumen protein retaining receptor 1 Alternative name(s): KDEL endoplasmic reticulum protein retention receptor 1 Short name= KDEL receptor 1 Putative MAPK-activating protein PM23
Gene Names:Name:KDELR1 Synonyms:ERD2.1
Expression Region:1-212
Sequence Info:Full length protein
