Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Epithelial membrane protein 2(EMP2)

Recombinant Human Epithelial membrane protein 2(EMP2)

SKU:CSB-CF007649HU

Regular price $2,115.40 CAD
Regular price Sale price $2,115.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P54851

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST LQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRR EDIHDKNAKFYPVTREGSYGYSYILAWVAFACTFISGMMYLILRKRK

Protein Names:Recommended name: Epithelial membrane protein 2 Short name= EMP-2 Alternative name(s): Protein XMP

Gene Names:Name:EMP2 Synonyms:XMP

Expression Region:1-167

Sequence Info:Full length protein

View full details