Recombinant Human Endothelin-1 receptor(EDNRA)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Endothelin-1 receptor(EDNRA)

CSB-CF007403HU
Regular price
$1,278.00 CAD
Sale price
$1,278.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Signal Transduction

Uniprot ID: P25101

Gene Names: EDNRA

Organism: Homo sapiens (Human)

AA Sequence: MASMTGGQQMGRGSDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGHNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPVHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKDHDQNNHNTDRSSHKDSMN

Expression Region: 21–427aa

Sequence Info: Full Length

Source: in vitro E.coli expression system

Tag Info: C-terminal 10xHis-tagged

MW: 49.9 kDa

Alternative Name(s): Endothelin A receptor

Relevance: Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.

Reference: "Molecular cloning of human endothelin receptors and their expression in vascular endothelial cells and smooth muscle cells."Arai H., Nakao K., Hosoda K., Ogawa Y., Nakagawa O., Komatsu Y., Imura H.Jpn. Circ. J. 56:1303-1307(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share