Gene Bio Systems
Recombinant Human Elongation of very long chain fatty acids protein 5(ELOVL5)
Recombinant Human Elongation of very long chain fatty acids protein 5(ELOVL5)
SKU:CSB-CF882144HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q9NYP7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFS CRGILVVYNLGLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSK LIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLM YSYYGLSSVPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMI SLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD
Protein Names:Recommended name: Elongation of very long chain fatty acids protein 5 EC= 2.3.1.n8 Alternative name(s): 3-keto acyl-CoA synthase ELOVL5 ELOVL fatty acid elongase 5 Short name= ELOVL FA elongase 5 Fatty acid elongase 1 Sho
Gene Names:Name:ELOVL5 Synonyms:ELOVL2 ORF Names:PRO0530
Expression Region:1-299
Sequence Info:full length protein
