Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human E3 ubiquitin-protein ligase RNF5(RNF5)

Recombinant Human E3 ubiquitin-protein ligase RNF5(RNF5)

SKU:CSB-CF857879HU

Regular price $2,133.60 CAD
Regular price Sale price $2,133.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q99942

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPER QECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFH FSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI

Protein Names:Recommended name: E3 ubiquitin-protein ligase RNF5 EC= 6.3.2.- Alternative name(s): Protein G16 RING finger protein 5 Ram1 homolog Short name= HsRma1

Gene Names:Name:RNF5 Synonyms:G16, NG2, RMA1

Expression Region:2-180

Sequence Info:full length protein

View full details