
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cell Cycle
Uniprot ID: O75935
Gene Names: DCTN3
Organism: Homo sapiens (Human)
AA Sequence: AGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH
Expression Region: 2-176aa
Sequence Info: Full Length of Isoform 2
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 35.3 kDa
Alternative Name(s): Dynactin complex subunit 22KDA subunit ;p22
Relevance: Together with dynein may be involved in spindle assbly and cytokinesis.
Reference: Characterization of the p22 subunit of dynactin reveals the localization of Cytoplasmic domain dynein and dynactin to the midbody of dividing cells.Karki S., LaMonte B., Holzbaur E.L.F.J. Cell Biol. 142:1023-1034(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.