Gene Bio Systems
Recombinant Human Duffy antigen-chemokine receptor(DARC)
Recombinant Human Duffy antigen-chemokine receptor(DARC)
SKU:CSB-CF624105HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q16570
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS ALP
Protein Names:Recommended name: Duffy antigen/chemokine receptorAlternative name(s): Fy glycoprotein Short name= GpFy Glycoprotein D Plasmodium vivax receptor CD_antigen= CD234
Gene Names:Name:DARCSynonyms:FY, GPD
Expression Region:1-63
Sequence Info:full length protein
