Recombinant Human Dihydropyrimidinase-related protein 2(DPYSL2)

Recombinant Human Dihydropyrimidinase-related protein 2(DPYSL2)

CSB-YP614975HU
Regular price
$792.00 CAD
Sale price
$792.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Developmental Biology

Target / Protein: DPYSL2

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q16555

AA Sequence: MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG

Tag info: N-terminal 6xHis-tagged

Expression Region: 1-572aa

Protein length: Full Length

MW: 64.3 kDa

Alternative Name(s): Collapsin response mediator protein 2 ;CRMP-2N2A3Unc-33-like phosphoprotein 2 ;ULIP-2

Relevance: Plays a role in neuronal development and polarity, as well as in axon growth and guidance, neuronal growth cone collapse and cell migration. Necessary for signaling by class 3 saphorins and subsequent rodeling of the cytoskeleton. May play a role in endocytosis.

Reference: Collapsin-induced growth cone collapse mediated by an intracellular protein related to UNC-33.Goshima Y., Nakamura F., Strittmatter P., Strittmatter S.M.Nature 376:509-514(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share