Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Cytotoxic and regulatory T-cell molecule (CRTAM), partial (Active)

Recombinant Human Cytotoxic and regulatory T-cell molecule (CRTAM), partial (Active)

SKU:O95727

Regular price $499.80 CAD
Regular price Sale price $499.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Signal Transduction

Uniprot ID: O95727

Gene Names: CRTAM

Alternative Name(s): Class-I MHC-restricted T-cell-associated molecule;CD355

Abbreviation: Recombinant Human CRTAM protein, partial (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 18-287aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSG

MW: 31.4 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CRTAM at 2 μg/mL can bind Human CADM1(CSB-MP004425HUd9) , the EC50 is 2.277-2.649 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Mediates heterophilic cell-cell adhesion which regulates the activation, differentiation and tissue retention of various T-cell subsets. Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and IFNG/interferon-gamma secretion by CD8+ T-cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM1 in vivo.

Reference: "A molecular analysis of NKT cells: identification of a class-I restricted T cell-associated molecule (CRTAM)." Kennedy J., Vicari A.P., Saylor V., Zurawski S.M., Copeland N.G., Gilbert D.J., Jenkins N.A., Zlotnik A. J. Leukoc. Biol. 67: 725-734 (2000)

Function:

View full details