Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)
Uniprot NO.:Q6SVX3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLKFFLKLRKRRRPVVVPRFVRFIVYVVLFTVAVQRVKQERDAHLRRYEERLQKNRARRR QSFP
Protein Names:Recommended name: Uncharacterized protein US34A
Gene Names:Name:US34A
Expression Region:1-64
Sequence Info:full length protein