Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human cytomegalovirus 65KDA phosphoprotein(UL83),partial

Recombinant Human cytomegalovirus 65KDA phosphoprotein(UL83),partial

SKU:CSB-EP361930HWV

Regular price $1,492.40 CAD
Regular price Sale price $1,492.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Microbiology

Uniprot ID: P06725

Gene Names: UL83

Organism: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

AA Sequence: FDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTSGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPA

Expression Region: 351-480

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 18.2 kDa

Alternative Name(s): 65KDA matrix phosphoprotein Phosphoprotein UL83 Tegument protein UL83

Relevance: Counteracts the host antiviral immune response when activated and phosphorylated, by preventing IRF3 from entering the nucleus. Also participates in the transactivation of viral major immediate-early genes by the recruitment of host IFI16 to the promoters pf these genes.

Reference: "Cloning and physical mapping of a gene fragment coding for a 64-kilodalton major late antigen of human cytomegalovirus."Pande H., Baak S.W., Riggs A.D., Clark B.R., Shively J.E., Zaia J.A.Proc. Natl. Acad. Sci. U.S.A. 81:4965-4969(1984)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details