Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Metabolism
Uniprot ID: P20674
Gene Names: COX5A
Organism: Homo sapiens (Human)
AA Sequence: SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Expression Region: 42-150aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 39.5 kDa
Alternative Name(s): Cytochrome c oxidase polypeptide Va
Relevance: This is the he A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Reference: Molecular evolution of the cytochrome c oxidase subunit 5A gene in primates.Uddin M., Opazo J.C., Wildman D.E., Sherwood C.C., Hof P.R., Goodman M., Grossman L.I.BMC Evol. Biol. 8:8-8(2008)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.