Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Cysteine and glycine-rich protein 2(CSRP2)

Recombinant Human Cysteine and glycine-rich protein 2(CSRP2)

SKU:CSB-RP069374h

Regular price $992.60 CAD
Regular price Sale price $992.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Developmental Biology

Uniprot ID: Q16527

Gene Names: CSRP2

Organism: Homo sapiens (Human)

AA Sequence: PVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ

Expression Region: 2-193aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 24.8 kDa

Alternative Name(s): Cysteine-rich protein 2 ;CRP2LIM domain only protein 5 ;LMO-5Smooth muscle cell LIM protein ;SmLIM

Relevance: Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Ses to play a role in the development of the bryonic vascular syst.

Reference: Molecular cloning and characterization of SmLIM, a developmentally regulated LIM protein preferentially expressed in aortic smooth muscle cells.Jain M., Fujita K.P., Hsieh C.-M., Endege W.O., Sibinga N.E.S., Yet S.-F., Kashiki S., Lee W.-S., Perrella M.A., Haber E., Lee M.-E.J. Biol. Chem. 271:10194-10199(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details