Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cell Biology
Uniprot ID: P04080
Gene Names: CSTB
Organism: Homo sapiens (Human)
AA Sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
Expression Region: 1-98aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 38.1 kDa
Alternative Name(s): CPI-BLiver thiol proteinase inhibitorStefin-B
Relevance: This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.
Reference: Amino acid sequence of the intracellular cysteine proteinase inhibitor cystatin B from human liver.Ritonja A., Machleidt W., Barrett A.J.Biochem. Biophys. Res. Commun. 131:1187-1192(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.