Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q9HC47
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFVIISLHNCVVISFVLFLFGGNNFIQNFYLPQNYIDQFLLTSFPTFTSVGVLIVLVLCS AFLLLWQGEGVNLR
Protein Names:Recommended name: Cutaneous T-cell lymphoma-associated antigen 1 Short name= Protein cTAGE-1 Alternative name(s): Cancer/testis antigen 21.1 Short name= CT21.1
Gene Names:Name:CTAGE1 Synonyms:CTAGE2
Expression Region:1-74
Sequence Info:full length protein