Recombinant Human Cutaneous T-cell lymphoma-associated antigen 1(CTAGE1)

SKU: CSB-CF006128HU

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9HC47

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFVIISLHNCVVISFVLFLFGGNNFIQNFYLPQNYIDQFLLTSFPTFTSVGVLIVLVLCS AFLLLWQGEGVNLR

Protein Names:Recommended name: Cutaneous T-cell lymphoma-associated antigen 1 Short name= Protein cTAGE-1 Alternative name(s): Cancer/testis antigen 21.1 Short name= CT21.1

Gene Names:Name:CTAGE1 Synonyms:CTAGE2

Expression Region:1-74

Sequence Info:full length protein