Gene Bio Systems
Recombinant Human CTD nuclear envelope phosphatase 1(CTDNEP1)
Recombinant Human CTD nuclear envelope phosphatase 1(CTDNEP1)
SKU:CSB-CF007227HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O95476
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW
Protein Names:Recommended name: CTD nuclear envelope phosphatase 1 EC= 3.1.3.16 Alternative name(s): Serine/threonine-protein phosphatase dullard
Gene Names:Name:CTDNEP1 Synonyms:DULLARD
Expression Region:1-244
Sequence Info:full length protein
