Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q4LDR2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDGGQPIPSSLVPLGNESADSSMSLEQKMTFVFVILLFIFLGILIVRCFRILLDPYRSMP TSTWADGLEGLEKGQFDHALA
Protein Names:Recommended name: Cortexin-3 Alternative name(s): Kidney and brain-expressed protein
Gene Names:Name:CTXN3 Synonyms:KABE
Expression Region:1-81
Sequence Info:full length protein