Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Connective tissue growth factor(CTGF),partial

Recombinant Human Connective tissue growth factor(CTGF),partial

SKU:CSB-RP094274h

Regular price $886.25 CAD
Regular price Sale price $886.25 CAD
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Cardiovascular

Target / Protein: CTGF

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P29279

AA Sequence: GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

Tag info: N-terminal 6xHis-tagged

Expression Region: 253-349aa

Protein length: Partial

MW: 15.1 kDa

Alternative Name(s): CCN family member 2Hypertrophic chondrocyte-specific protein 24Insulin-like growth factor-binding protein 8 ;IBP-8 ;IGF-binding protein 8 ;IGFBP-8

Relevance: Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.

Reference: Connective tissue growth factor a cysteine-rich mitogen secreted by human vascular endothelial cells is related to the SRC-induced immediate early gene product CEF-10.Bradham D.M., Igarashi A., Potter R.L., Grotendorst G.R.J. Cell Biol. 114:1285-1294(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details