Size: 20ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-25 working days
Research Topic: Cell Biology
Uniprot ID: Q9BWP8
Gene Names: COLEC11
Organism: Homo sapiens (Human)
AA Sequence: QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Expression Region: 26-271aa
Sequence Info: Full Length of Mature Protein
Source: Mammalian cell
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 30.1 kDa
Alternative Name(s): Collectin kidney protein 1 Short name:CL-K1
Relevance: Lectin that binds to various sugars including fucose and mannose. Has a higher affinity for fucose compared to mannose. Does not bind to glucose, N-acetylglucosamine and N-acetylgalactosamine. Also binds lipopolysaccharides (LPS). Involved in fundamental development serving as a guidance cue for neural crest cell migration
Reference: "Identification and characterization of a novel human collectin CL-K1."Keshi H., Sakamoto T., Kawai T., Ohtani K., Katoh T., Jang S.-J., Motomura W., Yoshizaki T., Fukuda M., Koyama S., Fukuzawa J., Fukuoh A., Yoshida I., Suzuki Y., Wakamiya N.Microbiol. Immunol. 50:1001-1013(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.