Gene Bio Systems
Recombinant Human Chloride intracellular channel protein 1(CLIC1)
Recombinant Human Chloride intracellular channel protein 1(CLIC1)
SKU:CSB-CF005545HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O00299
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPG GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNS NPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLL PKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Protein Names:Recommended name: Chloride intracellular channel protein 1 Alternative name(s): Chloride channel ABP Nuclear chloride ion channel 27 Short name= NCC27 Regulatory nuclear chloride ion channel protein Short name= hRNCC
Gene Names:Name:CLIC1 Synonyms:G6, NCC27
Expression Region:2-241
Sequence Info:Full length protein
